PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK14124.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NF-YC
Protein Properties Length: 327aa    MW: 36960.2 Da    PI: 5.6529
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK14124.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC62.77.2e-20381191798
      NF-YC  17 knhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98 
                 ++++P arikki+++dedv +is  +P l+ska elf+ +l  +++  ++++  +t++   ++++v + ++fdfl div +
  PK14124.1  38 LDTRFPAARIKKIMQTDEDVGKISMAVPLLVSKALELFLQDLCHQTYGITQQKGAKTMNALHLKQCVHSFNVFDFLKDIVSK 119
                3689***************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.55E-2025119IPR009072Histone-fold
Gene3DG3DSA:1.10.20.106.4E-2635105IPR009072Histone-fold
PfamPF008082.0E-1841104IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
XLCEFSRQKA RTTWVIRVFV FTPFHGHRLQ LPNMKKKLDT RFPAARIKKI MQTDEDVGKI  60
SMAVPLLVSK ALELFLQDLC HQTYGITQQK GAKTMNALHL KQCVHSFNVF DFLKDIVSKV  120
PDLGGSDTAA GEERSAAKKR KVVDTEGNNS DEDFQKNKMH EVGHHTSGRG RGRGRGRGRA  180
RGSRVRDKEA YHDTYEDDPD DFKYKKSNDQ NLEVLDDRAE PEGPKEKIAC DDSTKASVRN  240
FDLNVDLNET EDLTAVMTPP PVPVPVLTPV PFPAQTAQII PENKHGEYSG WSLADVEKMA  300
IDPIQLASLN RRMDEDDEDD EDYDEES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A2e-2231104174Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1170180RGRGRGRGRAR
2172181RGRGRGRARG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010106320.15e-95Dr1-associated corepressor
TrEMBLW9S4H15e-95W9S4H1_9R
STRINGVIT_06s0009g02120.t013e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17283491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G19490.13e-60NF-YC family protein